Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) not a true superfamily |
Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
Protein NSP4 oligomerization domain [58032] (1 species) |
Species Simian rotavirus, SA11 [TaxId:10922] [58033] (2 PDB entries) |
Domain d1g1ja_: 1g1j A: [45634] complexed with sr |
PDB Entry: 1g1j (more details), 1.86 Å
SCOPe Domain Sequences for d1g1ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ja_ h.1.13.1 (A:) NSP4 oligomerization domain {Simian rotavirus, SA11 [TaxId: 10922]} iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq
Timeline for d1g1ja_: