Lineage for d1g1ja_ (1g1j A:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266366Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 2266367Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 2266368Protein NSP4 oligomerization domain [58032] (1 species)
  7. 2266369Species Simian rotavirus, SA11 [TaxId:10922] [58033] (2 PDB entries)
  8. 2266370Domain d1g1ja_: 1g1j A: [45634]
    complexed with sr

Details for d1g1ja_

PDB Entry: 1g1j (more details), 1.86 Å

PDB Description: crystal structure of the oligomerization domain from rotavirus nsp4
PDB Compounds: (A:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d1g1ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ja_ h.1.13.1 (A:) NSP4 oligomerization domain {Simian rotavirus, SA11 [TaxId: 10922]}
iekqmdrvvkemrrqlemidklttreieqvellkriydkltvq

SCOPe Domain Coordinates for d1g1ja_:

Click to download the PDB-style file with coordinates for d1g1ja_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ja_:

2266370
d1g1ja_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1g1jb_