Lineage for d1g1ca_ (1g1c A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Titin [49172] (1 species) Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (7 PDB entries) 
Domain d1g1ca_: 1g1c A: [65078]
module I1
Details for d1g1ca_
PDB Entry: 1g1c (more details), 2.1 Å
PDB Description: i1 domain from titin
PDB Compounds: (A:) immunoglobulin-like domain i1 from titinSCOPe Domain Sequences for d1g1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
smeapkiferiqsqtvgqgsdahfrvrvvgkpdpecewykngvkiersdriywywpednv
celvirdvtgedsasimvkainiagetsshafllvqak
SCOPe Domain Coordinates for d1g1ca_:
Click to download the PDB-style file with coordinates for d1g1ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g1ca_:
- d1g1ca_ first appeared in SCOP 1.59
- d1g1ca_ appears in SCOPe 2.04
- d1g1ca_ appears in SCOPe 2.06
- d1g1ca_ appears in the current release, SCOPe 2.08
View in 3D
