Lineage for d1g1ca_ (1g1c A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1519014Protein Titin [49172] (1 species)
  7. 1519015Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (7 PDB entries)
  8. 1519019Domain d1g1ca_: 1g1c A: [65078]
    module I1

Details for d1g1ca_

PDB Entry: 1g1c (more details), 2.1 Å

PDB Description: i1 domain from titin
PDB Compounds: (A:) immunoglobulin-like domain i1 from titin

SCOPe Domain Sequences for d1g1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]}
smeapkiferiqsqtvgqgsdahfrvrvvgkpdpecewykngvkiersdriywywpednv
celvirdvtgedsasimvkainiagetsshafllvqak

SCOPe Domain Coordinates for d1g1ca_:

Click to download the PDB-style file with coordinates for d1g1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g1cb_