Lineage for d1g10a_ (1g10 A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1219230Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 1219231Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 1219232Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 1219243Protein Toluene-4-monooxygenase catalytic effector protein [64394] (1 species)
  7. 1219244Species Pseudomonas mendocina [TaxId:300] [64395] (15 PDB entries)
  8. 1219261Domain d1g10a_: 1g10 A: [60191]

Details for d1g10a_

PDB Entry: 1g10 (more details)

PDB Description: toluene-4-monooxygenase catalytic effector protein nmr structure
PDB Compounds: (A:) toluene-4-monooxygenase catalytic effector

SCOPe Domain Sequences for d1g10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g10a_ d.137.1.1 (A:) Toluene-4-monooxygenase catalytic effector protein {Pseudomonas mendocina [TaxId: 300]}
stladqalhnnnvgpiiragdlvepvietaeidnpgkeitvedrrayvriaaegeliltr
ktleeqlgrpfnmqeleinlasfagqiqadedqirfyfdktm

SCOPe Domain Coordinates for d1g10a_:

Click to download the PDB-style file with coordinates for d1g10a_.
(The format of our PDB-style files is described here.)

Timeline for d1g10a_: