Lineage for d1g0xa1 (1g0x A:2-97)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Ligand binding domain of lir-1 (ilt2) [49206] (1 species)
possibly an intermediate structure between the I set and FnIII domainsSpecies Human (Homo sapiens) [TaxId:9606] [49207] (5 PDB entries)
Uniprot Q8NHL6 25-218
Domain d1g0xa1: 1g0x A:2-97 [21805]
Details for d1g0xa1
PDB Entry: 1g0x (more details), 2.1 Å
PDB Description: crystal structure of the ligand binding domain of lir-1 (ilt2)
PDB Compounds: (A:) leucocyte immunoglobulin-like receptor-1SCOPe Domain Sequences for d1g0xa1:
Sequence, based on SEQRES records: (download)
>d1g0xa1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
hlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktapwitripqelvkkgqfp
ipsitwehagryrcyygsdtagrsessdplelvvtg
Sequence, based on observed residues (ATOM records): (download)
>d1g0xa1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]}
hlpkptlwaepgsvitqgspvtlrcqgtqeyrlyrekktapwitripqelvkkgqfpips
itwehagryrcyygsdtagrsessdplelvvtg
SCOPe Domain Coordinates for d1g0xa1:
Click to download the PDB-style file with coordinates for d1g0xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g0xa1:
- d1g0xa1 first appeared (with stable ids) in SCOP 1.55
- d1g0xa1 appears in SCOPe 2.03
- d1g0xa1 appears in SCOPe 2.05
- d1g0xa1 appears in the current release, SCOPe 2.08
View in 3D
