Lineage for d1fzpb_ (1fzp B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906657Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 906687Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
    closely related to SarR but adopts a different fold; possible experimental artifact?
  7. 906688Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries)
  8. 906693Domain d1fzpb_: 1fzp B: [19008]
    protein/DNA complex; complexed with ca

Details for d1fzpb_

PDB Entry: 1fzp (more details), 2.95 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
PDB Compounds: (B:) Staphylococcal accessory regulator A

SCOPe Domain Sequences for d1fzpb_:

Sequence, based on SEQRES records: (download)

>d1fzpb_ a.4.5.28 (B:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit

Sequence, based on observed residues (ATOM records): (download)

>d1fzpb_ a.4.5.28 (B:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit

SCOPe Domain Coordinates for d1fzpb_:

Click to download the PDB-style file with coordinates for d1fzpb_.
(The format of our PDB-style files is described here.)

Timeline for d1fzpb_: