Lineage for d1fywa_ (1fyw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856197Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (2 families) (S)
  5. 2856198Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (3 proteins)
    automatically mapped to Pfam PF01582
  6. 2856202Protein Toll-like receptor 2, TLR2 [52204] (1 species)
  7. 2856203Species Human (Homo sapiens) [TaxId:9606] [52205] (3 PDB entries)
  8. 2856210Domain d1fywa_: 1fyw A: [31129]

Details for d1fywa_

PDB Entry: 1fyw (more details), 3 Å

PDB Description: crystal structure of the tir domain of human tlr2
PDB Compounds: (A:) toll-like receptor 2

SCOPe Domain Sequences for d1fywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fywa_ c.23.2.1 (A:) Toll-like receptor 2, TLR2 {Human (Homo sapiens) [TaxId: 9606]}
srnicydafvsyserdaywvenlmvqelenfnppfklclhkrdfipgkwiidniidsiek
shktvfvlsenfvksewckyeldfshfrlfdenndaailillepiekkaipqrfcklrki
mntktylewpmdeaqregfwvnlraaiks

SCOPe Domain Coordinates for d1fywa_:

Click to download the PDB-style file with coordinates for d1fywa_.
(The format of our PDB-style files is described here.)

Timeline for d1fywa_: