Lineage for d1fw1a1 (1fw1 A:88-212)
- Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds) 
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelixSuperfamily a.45.1: GST C-terminal domain-like [47616] (3 families) 
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) 
Protein Class zeta GST [81353] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [63555] (1 PDB entry)
maleylacetoacetate isomerase
Domain d1fw1a1: 1fw1 A:88-212 [60051]
Other proteins in same PDB: d1fw1a2
complexed with dtt, gsh, so4
Details for d1fw1a1
PDB Entry: 1fw1 (more details), 1.9 Å
PDB Description: Glutathione transferase zeta/maleylacetoacetate isomerase
PDB Compounds: (A:) glutathione transferase zetaSCOPe Domain Sequences for d1fw1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}
llpqdpkkrasvrmisdliaggiqplqnlsvlkqvgeemqltwaqnaitcgfnaleqilq
stagiycvgdevtmadlclvpqvanaerfkvdltpyptissinkrllvleafqvshpcrq
pdtpt
SCOPe Domain Coordinates for d1fw1a1:
Click to download the PDB-style file with coordinates for d1fw1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fw1a1:
- d1fw1a1 first appeared in SCOP 1.57
- d1fw1a1 appears in SCOPe 2.05
- d1fw1a1 appears in SCOPe 2.07
- d1fw1a1 appears in the current release, SCOPe 2.08
View in 3D
