Lineage for d1fvua_ (1fvu A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2234944Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 2234961Species Jararaca (Bothrops jararaca), botrocetin [TaxId:8724] [88864] (4 PDB entries)
  8. 2234962Domain d1fvua_: 1fvu A: [42345]
    Other proteins in same PDB: d1fvub_, d1fvud_
    complexed with mg

Details for d1fvua_

PDB Entry: 1fvu (more details), 1.8 Å

PDB Description: crystal structure of botrocetin
PDB Compounds: (A:) botrocetin alpha chain

SCOPe Domain Sequences for d1fvua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fvua_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Jararaca (Bothrops jararaca), botrocetin [TaxId: 8724]}
dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
aqknpfvcksppp

SCOPe Domain Coordinates for d1fvua_:

Click to download the PDB-style file with coordinates for d1fvua_.
(The format of our PDB-style files is described here.)

Timeline for d1fvua_: