Lineage for d1fvab_ (1fva B:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) 
common fold is elaborated with additional secondary structuresFamily d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) 
Protein Peptide methionine sulfoxide reductase [55070] (4 species) 
Species Cow (Bos taurus) [TaxId:9913] [55071] (2 PDB entries) 
Domain d1fvab_: 1fva B: [39410]
Details for d1fvab_
PDB Entry: 1fva (more details), 1.7 Å
PDB Description: crystal structure of bovine methionine sulfoxide reductase
PDB Compounds: (B:) peptide methionine sulfoxide reductaseSCOPe Domain Sequences for d1fvab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fvab_ d.58.28.1 (B:) Peptide methionine sulfoxide reductase {Cow (Bos taurus) [TaxId: 9913]}
ivspqealpgrkeplvvaakhhvngnrtvepfpegtqmavfgmgcfwgaerkfwtlkgvy
stqvgfaggytpnptykevcsgktghaevvrvvfqpehisfeellkvfwenhdptqgmrq
gndhgsqyrsaiyptsaehvgaalkskedyqkvlsehgfglittdiregqtfyyaedyhq
qylskdpdgycglggtgvscp
SCOPe Domain Coordinates for d1fvab_:
Click to download the PDB-style file with coordinates for d1fvab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fvab_:
View in 3D
