Lineage for d1fu5a_ (1fu5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965548Protein Phosphatidylinositol 3-kinase, p85-alpha subunit [55569] (3 species)
  7. 2965560Species Norway rat (Rattus norvegicus) [TaxId:10116] [55572] (2 PDB entries)
  8. 2965562Domain d1fu5a_: 1fu5 A: [40505]

Details for d1fu5a_

PDB Entry: 1fu5 (more details)

PDB Description: nmr structure of the n-sh2 domain of the p85 subunit of pi3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle t antigen
PDB Compounds: (A:) phosphatidylinositol 3-kinase regulatory alpha subunit

SCOPe Domain Sequences for d1fu5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fu5a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gmnnnmslqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnks
ikifhrdgkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky

SCOPe Domain Coordinates for d1fu5a_:

Click to download the PDB-style file with coordinates for d1fu5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fu5a_: