![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
![]() | Protein Fushi Tarazu protein [46722] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46723] (1 PDB entry) |
![]() | Domain d1ftza_: 1ftz A: [16012] |
PDB Entry: 1ftz (more details)
SCOPe Domain Sequences for d1ftza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftza_ a.4.1.1 (A:) Fushi Tarazu protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} mdskrtrqtytryqtlelekefhfnryitrrrridianalslserqikiwfqnrrmkskk drtldsspeh
Timeline for d1ftza_: