Lineage for d1ftra2 (1ftr A:149-296)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 863823Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) (S)
    duplication: contains two subdomains of this fold
  5. 863824Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein)
  6. 863825Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species)
  7. 863843Species Archaeon Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries)
  8. 863845Domain d1ftra2: 1ftr A:149-296 [39486]

Details for d1ftra2

PDB Entry: 1ftr (more details), 1.7 Å

PDB Description: formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri
PDB Compounds: (A:) formylmethanofuran:tetrahydromethanopterin formyltransferase

SCOP Domain Sequences for d1ftra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ftra2 d.58.33.1 (A:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]}
egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa
skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac
qqpgvvkisagnfggklgqyeihlhdlf

SCOP Domain Coordinates for d1ftra2:

Click to download the PDB-style file with coordinates for d1ftra2.
(The format of our PDB-style files is described here.)

Timeline for d1ftra2: