Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.33: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55112] (1 family) duplication: contains two subdomains of this fold |
Family d.58.33.1: Formylmethanofuran:tetrahydromethanopterin formyltransferase [55113] (1 protein) |
Protein Formylmethanofuran:tetrahydromethanopterin formyltransferase [55114] (3 species) |
Species Archaeon Methanopyrus kandleri [TaxId:2320] [55115] (3 PDB entries) |
Domain d1ftra2: 1ftr A:149-296 [39486] |
PDB Entry: 1ftr (more details), 1.7 Å
SCOP Domain Sequences for d1ftra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ftra2 d.58.33.1 (A:149-296) Formylmethanofuran:tetrahydromethanopterin formyltransferase {Archaeon Methanopyrus kandleri [TaxId: 2320]} egefivedsfgittgvaggnfyimaesqpaglqaaeaavdaikgvegayapfpggivasa skvgskqydflpastndaycptvednelpegvkcvyeivinglneeavkeamrvgieaac qqpgvvkisagnfggklgqyeihlhdlf
Timeline for d1ftra2: