Lineage for d1ft3a_ (1ft3 A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (24 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.8: RhoGDI-like [81288] (3 proteins) Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (3 species) Species Human (Homo sapiens) [TaxId:9606] [49242] (12 PDB entries) 
Domain d1ft3a_: 1ft3 A: [60020]
mutant
Details for d1ft3a_
PDB Entry: 1ft3 (more details), 2.8 Å
PDB Description: crystal structure of truncated rhogdi k141a mutant
PDB Compounds: (A:) rho GDP-dissociation inhibitor 1SCOPe Domain Sequences for d1ft3a_:
Sequence, based on SEQRES records: (download)
>d1ft3a_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
mvpnvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsg
mkyiqhtyrkgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftddd
ktdhlswewnltikkdwk
Sequence, based on observed residues (ATOM records): (download)
>d1ft3a_ b.1.18.8 (A:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
mvpnvvvtgltlvcssapgpleldltsfvlkegveyrikisfrvnreivsgmkyiqhtyr
kgvkidatdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswew
nltikkdwk
SCOPe Domain Coordinates for d1ft3a_:
Click to download the PDB-style file with coordinates for d1ft3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ft3a_:
- d1ft3a_ first appeared in SCOP 1.57
- d1ft3a_ appears in SCOPe 2.04
- d1ft3a_ is called d1ft3a1 in SCOPe 2.06
- d1ft3a_ appears in the current release, SCOPe 2.08, called d1ft3a1
View in 3D
