Lineage for d1fsxa_ (1fsx A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1254022Protein Hemoglobin, alpha-chain [46486] (23 species)
  7. 1254057Species Cow (Bos taurus) [TaxId:9913] [46490] (11 PDB entries)
  8. 1254070Domain d1fsxa_: 1fsx A: [60012]
    Other proteins in same PDB: d1fsxb_, d1fsxd_
    complexed with cmo, hem

Details for d1fsxa_

PDB Entry: 1fsx (more details), 2.1 Å

PDB Description: the x-ray structure determination of bovine carbonmonoxy hb at 2.1 a resolution and its relationship to the quaternary structure of other hb crystal forms
PDB Compounds: (A:) hemoglobin alpha chain

SCOPe Domain Sequences for d1fsxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsxa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d1fsxa_:

Click to download the PDB-style file with coordinates for d1fsxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fsxa_: