Lineage for d1fsea_ (1fse A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984691Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) (S)
    binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family
  5. 1984723Family a.4.6.2: GerE-like (LuxR/UhpA family of transcriptional regulators) [46900] (5 proteins)
    contains additional, fourth helix in the C-terminal extension
  6. 1984724Protein Germination protein GerE [63488] (1 species)
    single-domain protein homologous to the C-terminal domain of NarL
  7. 1984725Species Bacillus subtilis [TaxId:1423] [63489] (1 PDB entry)
  8. 1984726Domain d1fsea_: 1fse A: [60000]
    complexed with gol, so4

Details for d1fsea_

PDB Entry: 1fse (more details), 2.05 Å

PDB Description: crystal structure of the bacillus subtilis regulatory protein gere
PDB Compounds: (A:) gere

SCOPe Domain Sequences for d1fsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]}
skplltkrerevfellvqdkttkeiaselfisektvrnhisnamqklgvkgrsqavvell
rmgelel

SCOPe Domain Coordinates for d1fsea_:

Click to download the PDB-style file with coordinates for d1fsea_.
(The format of our PDB-style files is described here.)

Timeline for d1fsea_: