Lineage for d1fqta_ (1fqt A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.33: ISP domain [50021] (1 superfamily)
consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)Superfamily b.33.1: ISP domain [50022] (4 families) 
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) 
Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species) Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry) 
Domain d1fqta_: 1fqt A: [24441]
complexed with fes, gol
Details for d1fqta_
PDB Entry: 1fqt (more details), 1.6 Å
PDB Description: crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase
PDB Compounds: (A:) rieske-type ferredoxin of biphenyl dioxygenaseSCOPe Domain Sequences for d1fqta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]}
mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv
vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap
SCOPe Domain Coordinates for d1fqta_:
Click to download the PDB-style file with coordinates for d1fqta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fqta_:
- d1fqta_ first appeared (with stable ids) in SCOP 1.55
- d1fqta_ appears in SCOPe 2.03
- d1fqta_ appears in SCOPe 2.05
- d1fqta_ appears in the current release, SCOPe 2.08
View in 3D
