Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein Rieske-type ferredoxin associated with biphenyl dioxygenase [50031] (1 species) |
Species Burkholderia cepacia [TaxId:292] [50032] (1 PDB entry) |
Domain d1fqta_: 1fqt A: [24441] complexed with fes, gol |
PDB Entry: 1fqt (more details), 1.6 Å
SCOPe Domain Sequences for d1fqta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} mkftrvcdrrdvpegealkvesggtsvaifnvdgelfatqdrcthgdwslsdggylegdv vecslhmgkfcvrtgkvkspppcealkifpiriedndvlvdfeagylap
Timeline for d1fqta_: