| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
| Protein Isoflavone O-methyltransferase [63478] (1 species) |
| Species Alfalfa (Medicago sativa) [TaxId:3879] [63479] (2 PDB entries) |
| Domain d1fp2a1: 1fp2 A:8-108 [59941] Other proteins in same PDB: d1fp2a2 complexed with hmo, sah |
PDB Entry: 1fp2 (more details), 1.4 Å
SCOPe Domain Sequences for d1fp2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fp2a1 a.4.5.29 (A:8-108) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
rkpseifkaqallykhiyafidsmslkwavemnipniiqnhgkpislsnlvsilqvpssk
ignvrrlmrylahngffeiitkeeesyaltvasellvrgsd
Timeline for d1fp2a1: