Lineage for d1fo4a4 (1fo4 A:415-531)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1660045Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 1660205Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 1660206Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 1660246Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 1660247Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries)
    Uniprot P80457
  8. 1660256Domain d1fo4a4: 1fo4 A:415-531 [40227]
    Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a3, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b3, d1fo4b5, d1fo4b6
    complexed with ca, fad, fes, gol, mos, mte, sal

Details for d1fo4a4

PDB Entry: 1fo4 (more details), 2.1 Å

PDB Description: crystal structure of xanthine dehydrogenase isolated from bovine milk
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1fo4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo4a4 d.87.2.1 (A:415-531) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkds

SCOPe Domain Coordinates for d1fo4a4:

Click to download the PDB-style file with coordinates for d1fo4a4.
(The format of our PDB-style files is described here.)

Timeline for d1fo4a4: