Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
Protein Xanthine oxidase, domain 5 (?) [54670] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [54671] (9 PDB entries) Uniprot P80457 |
Domain d1fo4a3: 1fo4 A:537-694 [38586] Other proteins in same PDB: d1fo4a1, d1fo4a2, d1fo4a4, d1fo4a5, d1fo4a6, d1fo4b1, d1fo4b2, d1fo4b4, d1fo4b5, d1fo4b6 complexed with ca, fad, fes, gol, mos, mte, sal |
PDB Entry: 1fo4 (more details), 2.1 Å
SCOPe Domain Sequences for d1fo4a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fo4a3 d.41.1.1 (A:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]} kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa
Timeline for d1fo4a3: