Lineage for d1fnsh2 (1fns H:337-439)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107361Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1107666Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1107710Domain d1fnsh2: 1fns H:337-439 [21281]
    Other proteins in same PDB: d1fnsa_, d1fnsh1, d1fnsl1, d1fnsl2
    part of Fab NMC-4 blocking the von willebrand factor (vwf) a1 domain function
    mutant

Details for d1fnsh2

PDB Entry: 1fns (more details), 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
PDB Compounds: (H:) immunoglobulin nmc-4 igg1

SCOPe Domain Sequences for d1fnsh2:

Sequence, based on SEQRES records: (download)

>d1fnsh2 b.1.1.2 (H:337-439) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

Sequence, based on observed residues (ATOM records): (download)

>d1fnsh2 b.1.1.2 (H:337-439) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

SCOPe Domain Coordinates for d1fnsh2:

Click to download the PDB-style file with coordinates for d1fnsh2.
(The format of our PDB-style files is described here.)

Timeline for d1fnsh2: