Lineage for d1fnsh2 (1fns H:337-439)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655381Domain d1fnsh2: 1fns H:337-439 [21281]
    Other proteins in same PDB: d1fnsa_, d1fnsh1, d1fnsl1, d1fnsl2
    part of Fab NMC-4 blocking the von willebrand factor (vwf) a1 domain function
    mutant

Details for d1fnsh2

PDB Entry: 1fns (more details), 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
PDB Compounds: (H:) immunoglobulin nmc-4 igg1

SCOP Domain Sequences for d1fnsh2:

Sequence, based on SEQRES records: (download)

>d1fnsh2 b.1.1.2 (H:337-439) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

Sequence, based on observed residues (ATOM records): (download)

>d1fnsh2 b.1.1.2 (H:337-439) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivprdcg

SCOP Domain Coordinates for d1fnsh2:

Click to download the PDB-style file with coordinates for d1fnsh2.
(The format of our PDB-style files is described here.)

Timeline for d1fnsh2: