![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]() |
![]() | Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals |
![]() | Protein Elongation factor G (EF-G) [54982] (2 species) domain III is seen in 1FNM but disordered in the most of other PDB entries |
![]() | Species Thermus thermophilus [TaxId:274] [54983] (9 PDB entries) |
![]() | Domain d1fnma4: 1fnm A:404-482 [39302] Other proteins in same PDB: d1fnma1, d1fnma2, d1fnma3 |
PDB Entry: 1fnm (more details), 2.8 Å
SCOP Domain Sequences for d1fnma4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnma4 d.58.11.1 (A:404-482) Elongation factor G (EF-G) {Thermus thermophilus [TaxId: 274]} vpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiiv drlkrefkvdanvgkpqva
Timeline for d1fnma4:
![]() Domains from same chain: (mouse over for more information) d1fnma1, d1fnma2, d1fnma3, d1fnma5 |