| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries) Uniprot O75015 23-189 |
| Domain d1fnla2: 1fnl A:87-175 [21784] complexed with hg |
PDB Entry: 1fnl (more details), 1.8 Å
SCOPe Domain Sequences for d1fnla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkdrkyfhhnsdfhipkatl
kdsgsyfcrglvgsknvssetvnititqa
Timeline for d1fnla2: