Lineage for d1fnla1 (1fnl A:3-86)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
possibly an intermediate structure between the I set and FnIII domains
Species Human (Homo sapiens), III [TaxId:9606] [49199] (5 PDB entries)
Uniprot O75015 23-189
Domain d1fnla1: 1fnl A:3-86 [21783]
complexed with hg
Details for d1fnla1
PDB Entry: 1fnl (more details), 1.8 Å
PDB Description: crystal structure of the extracellular domain of a human fcgriii
PDB Compounds: (A:) low affinity immunoglobulin gamma fc region receptor III-bSCOPe Domain Sequences for d1fnla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
edlpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaat
vndsgeyrcqtnlstlsdpvqlev
SCOPe Domain Coordinates for d1fnla1:
Click to download the PDB-style file with coordinates for d1fnla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fnla1:
- d1fnla1 first appeared (with stable ids) in SCOP 1.55
- d1fnla1 appears in SCOPe 2.04
- d1fnla1 appears in SCOPe 2.06
- d1fnla1 appears in the current release, SCOPe 2.08
View in 3D
