Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries) |
Domain d1fmka1: 1fmk A:82-145 [24511] Other proteins in same PDB: d1fmka2, d1fmka3 |
PDB Entry: 1fmk (more details), 1.5 Å
SCOPe Domain Sequences for d1fmka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd siqa
Timeline for d1fmka1: