Lineage for d1fmka1 (1fmk A:82-145)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392578Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2392593Species Human (Homo sapiens) [TaxId:9606] [50065] (6 PDB entries)
  8. 2392594Domain d1fmka1: 1fmk A:82-145 [24511]
    Other proteins in same PDB: d1fmka2, d1fmka3

Details for d1fmka1

PDB Entry: 1fmk (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src
PDB Compounds: (A:) tyrosine-protein kinase src

SCOPe Domain Sequences for d1fmka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
mvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsd
siqa

SCOPe Domain Coordinates for d1fmka1:

Click to download the PDB-style file with coordinates for d1fmka1.
(The format of our PDB-style files is described here.)

Timeline for d1fmka1: