Lineage for d1fmca_ (1fmc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2103117Protein 7-alpha-hydroxysteroid dehydrogenase [51774] (1 species)
  7. 2103118Species Escherichia coli [TaxId:562] [51775] (3 PDB entries)
  8. 2103119Domain d1fmca_: 1fmc A: [29856]
    complexed with cho, nai

Details for d1fmca_

PDB Entry: 1fmc (more details), 1.8 Å

PDB Description: 7-alpha-hydroxysteroid dehydrogenase complex with nadh and 7-oxo glycochenodeoxycholic acid
PDB Compounds: (A:) 7 alpha-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d1fmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}
mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg
qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf
sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek
nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs
gqiltvsgggvqeln

SCOPe Domain Coordinates for d1fmca_:

Click to download the PDB-style file with coordinates for d1fmca_.
(The format of our PDB-style files is described here.)

Timeline for d1fmca_: