Lineage for d1flja_ (1flj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1804999Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1805000Protein Carbonic anhydrase [51071] (10 species)
  7. 1805678Species Norway rat (Rattus norvegicus), isozyme III [TaxId:10116] [51075] (1 PDB entry)
  8. 1805679Domain d1flja_: 1flj A: [27954]
    S-glutathiolated
    complexed with gsh, zn

Details for d1flja_

PDB Entry: 1flj (more details), 1.8 Å

PDB Description: crystal structure of s-glutathiolated carbonic anhydrase iii
PDB Compounds: (A:) Carbonic anhydrase III

SCOPe Domain Sequences for d1flja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Norway rat (Rattus norvegicus), isozyme III [TaxId: 10116]}
akewgyashngpehwhelypiakgdnqspielhtkdirhdpslqpwsvsydpgsaktiln
ngktcrvvfddtfdrsmlrggplsgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
hwnpkyntfgealkqpdgiavvgiflkigrekgefqilldaldkiktkgkeapfnhfdps
clfpacrdywtyhgsfttppceecivwlllkepmtvssdqmaklrslfasaeneppvplv
gnwrppqpikgrvvrasfk

SCOPe Domain Coordinates for d1flja_:

Click to download the PDB-style file with coordinates for d1flja_.
(The format of our PDB-style files is described here.)

Timeline for d1flja_: