Class b: All beta proteins [48724] (174 folds) |
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) |
Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins) |
Protein Carbonic anhydrase [51071] (10 species) |
Species Rat (Rattus norvegicus), isozyme III [TaxId:10116] [51075] (1 PDB entry) |
Domain d1flja_: 1flj A: [27954] S-glutathiolated complexed with gsh, zn |
PDB Entry: 1flj (more details), 1.8 Å
SCOPe Domain Sequences for d1flja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} akewgyashngpehwhelypiakgdnqspielhtkdirhdpslqpwsvsydpgsaktiln ngktcrvvfddtfdrsmlrggplsgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv hwnpkyntfgealkqpdgiavvgiflkigrekgefqilldaldkiktkgkeapfnhfdps clfpacrdywtyhgsfttppceecivwlllkepmtvssdqmaklrslfasaeneppvplv gnwrppqpikgrvvrasfk
Timeline for d1flja_: