Lineage for d1fkla_ (1fkl A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408347Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1408348Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1408349Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1408360Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1408361Species Cow (Bos taurus) [TaxId:9913] [54538] (2 PDB entries)
  8. 1408362Domain d1fkla_: 1fkl A: [38423]
    complexed with rap

Details for d1fkla_

PDB Entry: 1fkl (more details), 1.7 Å

PDB Description: atomic structure of fkbp12-rapaymycin, an immunophilin-immunosuppressant complex
PDB Compounds: (A:) fk506 binding protein

SCOPe Domain Sequences for d1fkla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkla_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Cow (Bos taurus) [TaxId: 9913]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfvlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiippnatlifdvellkle

SCOPe Domain Coordinates for d1fkla_:

Click to download the PDB-style file with coordinates for d1fkla_.
(The format of our PDB-style files is described here.)

Timeline for d1fkla_: