![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
![]() | Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) cis-trans prolyl-isomerase |
![]() | Species Cow (Bos taurus) [TaxId:9913] [54538] (2 PDB entries) |
![]() | Domain d1fkla_: 1fkl A: [38423] complexed with rap |
PDB Entry: 1fkl (more details), 1.7 Å
SCOPe Domain Sequences for d1fkla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkla_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Cow (Bos taurus) [TaxId: 9913]} gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfvlgkqevirgwe egvaqmsvgqrakltispdyaygatghpgiippnatlifdvellkle
Timeline for d1fkla_: