Lineage for d1fk5a_ (1fk5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714860Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2714861Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2714862Family a.52.1.1: Plant lipid-transfer and hydrophobic proteins [47700] (4 proteins)
  6. 2714870Protein Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) [47703] (4 species)
  7. 2714880Species Maize (Zea mays) [TaxId:4577] [47706] (11 PDB entries)
  8. 2714881Domain d1fk5a_: 1fk5 A: [59866]
    complexed with fmt, ola

Details for d1fk5a_

PDB Entry: 1fk5 (more details), 1.3 Å

PDB Description: structural basis of non-specific lipid binding in maize lipid-transfer protein complexes with oleic acid revealed by high-resolution x-ray crystallography
PDB Compounds: (A:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d1fk5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fk5a_ a.52.1.1 (A:) Plant non-specific lipid-transfer protein (ns-LTP, ns-LTP1) {Maize (Zea mays) [TaxId: 4577]}
aiscgqvasaiapcisyargqgsgpsagccsgvrslnnaarttadrraacnclknaaagv
sglnagnaasipskcgvsipytiststdcsrvn

SCOPe Domain Coordinates for d1fk5a_:

Click to download the PDB-style file with coordinates for d1fk5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fk5a_: