Lineage for d1fjra_ (1fjr A:)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.102: Methuselah ectodomain [63876] (1 superfamily)
complex foldSuperfamily b.102.1: Methuselah ectodomain [63877] (1 family) 
duplication: contains two similar sub domains connected by a structured linkerFamily b.102.1.1: Methuselah ectodomain [63878] (1 protein) Protein Methuselah ectodomain [63879] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (2 PDB entries) 
Domain d1fjra_: 1fjr A: [59855]
Details for d1fjra_
PDB Entry: 1fjr (more details), 2.3 Å
PDB Description: crystal structure of the ectodomain of methuselah
PDB Compounds: (A:) methuselah ectodomainSCOP Domain Sequences for d1fjra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjra_ b.102.1.1 (A:) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
aphncliv
SCOP Domain Coordinates for d1fjra_:
Click to download the PDB-style file with coordinates for d1fjra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fjra_:
- d1fjra_ first appeared in SCOP 1.57
- d1fjra_ appears in SCOP 1.73
- d1fjra_ appears in SCOPe 2.01
- d1fjra_ appears in the current release, SCOPe 2.08
View in 3D
