Lineage for d1fjra_ (1fjr A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820783Fold b.102: Methuselah ectodomain [63876] (1 superfamily)
    complex fold
  4. 2820784Superfamily b.102.1: Methuselah ectodomain [63877] (1 family) (S)
    duplication: contains two similar sub domains connected by a structured linker
    automatically mapped to Pfam PF06652
  5. 2820785Family b.102.1.1: Methuselah ectodomain [63878] (1 protein)
  6. 2820786Protein Methuselah ectodomain [63879] (1 species)
  7. 2820787Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (2 PDB entries)
  8. 2820788Domain d1fjra_: 1fjr A: [59855]
    complexed with nag, pb, so4

Details for d1fjra_

PDB Entry: 1fjr (more details), 2.3 Å

PDB Description: crystal structure of the ectodomain of methuselah
PDB Compounds: (A:) methuselah ectodomain

SCOPe Domain Sequences for d1fjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjra_ b.102.1.1 (A:) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv
cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw
dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri
aphncliv

SCOPe Domain Coordinates for d1fjra_:

Click to download the PDB-style file with coordinates for d1fjra_.
(The format of our PDB-style files is described here.)

Timeline for d1fjra_: