Class b: All beta proteins [48724] (180 folds) |
Fold b.102: Methuselah ectodomain [63876] (1 superfamily) complex fold |
Superfamily b.102.1: Methuselah ectodomain [63877] (1 family) duplication: contains two similar sub domains connected by a structured linker automatically mapped to Pfam PF06652 |
Family b.102.1.1: Methuselah ectodomain [63878] (1 protein) |
Protein Methuselah ectodomain [63879] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [63880] (2 PDB entries) |
Domain d1fjra_: 1fjr A: [59855] complexed with nag, pb, so4 |
PDB Entry: 1fjr (more details), 2.3 Å
SCOPe Domain Sequences for d1fjra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjra_ b.102.1.1 (A:) Methuselah ectodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dilecdyfdtvdisaaqklqngsylfegllvpailtgeydfrilpddskqkvarhirgcv cklkpcvrfccphdhimdngvcydnmsdeelaeldpflnvtlddgsvsrrhfknelivqw dlpmpcdgmfyldnreeqdkytlfengtffrhfdrvtlrkreyclqhltfadgnatsiri aphncliv
Timeline for d1fjra_: