Lineage for d1fjma_ (1fjm A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604090Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2604161Species Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId:9986] [56312] (1 PDB entry)
  8. 2604162Domain d1fjma_: 1fjm A: [42082]
    complexed with bme, mn

Details for d1fjma_

PDB Entry: 1fjm (more details), 2.1 Å

PDB Description: Protein serine/threonine phosphatase-1 (alpha isoform, type 1) complexed with microcystin-LR toxin
PDB Compounds: (A:) protein serine/threonine phosphatase-1 (alpha isoform, type 1)

SCOPe Domain Sequences for d1fjma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjma_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Rabbit (Oryctolagus cuniculus), alpha isoform [TaxId: 9986]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

SCOPe Domain Coordinates for d1fjma_:

Click to download the PDB-style file with coordinates for d1fjma_.
(The format of our PDB-style files is described here.)

Timeline for d1fjma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fjmb_