Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
Protein Xanthine oxidase, domain 5 (?) [54670] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries) Uniprot P80457 |
Domain d1fiqc1: 1fiq C:571-694 [38588] Other proteins in same PDB: d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc2 complexed with fad, fes, gol, mos, mte, sal |
PDB Entry: 1fiq (more details), 2.5 Å
SCOPe Domain Sequences for d1fiqc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fiqc1 d.41.1.1 (C:571-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]} dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye dlpa
Timeline for d1fiqc1:
View in 3D Domains from other chains: (mouse over for more information) d1fiqa1, d1fiqa2, d1fiqb1, d1fiqb2 |