| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.26.2: Mevalonate 5-diphosphate decarboxylase [64281] (1 protein) |
| Protein Mevalonate 5-diphosphate decarboxylase [64282] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64283] (1 PDB entry) |
| Domain d1fi4a2: 1fi4 A:191-393 [59848] Other proteins in same PDB: d1fi4a1 |
PDB Entry: 1fi4 (more details), 2.27 Å
SCOPe Domain Sequences for d1fi4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fi4a2 d.58.26.2 (A:191-393) Mevalonate 5-diphosphate decarboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qmkacvlvvsdikkdvsstqgmqltvatselfkeriehvvpkrfevmrkaivekdfatfa
ketmmdsnsfhatcldsfppifymndtskriiswchtinqfygetivaytfdagpnavly
ylaenesklfafiyklfgsvpgwdkkftteqleafnhqfessnftareldlelqkdvarv
iltqvgsgpqetneslidaktgl
Timeline for d1fi4a2: