Lineage for d1fi2a_ (1fi2 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 809794Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 809805Protein Germin [63853] (1 species)
    Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer
  7. 809806Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)
  8. 809808Domain d1fi2a_: 1fi2 A: [59845]
    complexed with mn

Details for d1fi2a_

PDB Entry: 1fi2 (more details), 1.6 Å

PDB Description: crystal structure of germin (oxalate oxidase)
PDB Compounds: (A:) oxalate oxidase

SCOP Domain Sequences for d1fi2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi2a_ b.82.1.2 (A:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

SCOP Domain Coordinates for d1fi2a_:

Click to download the PDB-style file with coordinates for d1fi2a_.
(The format of our PDB-style files is described here.)

Timeline for d1fi2a_: