Lineage for d1fi2a_ (1fi2 A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. Protein Germin [63853] (1 species)
    Metal (manganese)-binding protein with oxalate oxidase and superoxide dismutase activities; homohexamer
  7. Species Barley (Hordeum vulgare) [TaxId:4513] [63854] (4 PDB entries)
  8. Domain d1fi2a_: 1fi2 A: [59845]
    complexed with mn
    has additional insertions and/or extensions that are not grouped together

Details for d1fi2a_

PDB Entry: 1fi2 (more details), 1.6 Å

PDB Description: crystal structure of germin (oxalate oxidase)
PDB Compounds: (A:) oxalate oxidase

SCOPe Domain Sequences for d1fi2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fi2a_ b.82.1.2 (A:) Germin {Barley (Hordeum vulgare) [TaxId: 4513]}
tdpdplqdfcvadldgkavsvnghtckpmseagddflfsskltkagntstpngsavteld
vaewpgtntlgvsmnrvdfapggtnpphihprateigmvmkgellvgilgsldsgnklys
rvvragetfviprglmhfqfnvgkteaymvvsfnsqnpgivfvpltlfgsdppiptpvlt
kalrveagvvellkskfaggs

SCOPe Domain Coordinates for d1fi2a_ are not available.

Timeline for d1fi2a_: