Lineage for d1fhxb_ (1fhx B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
Pfam PF00169
Protein Grp1 [50751] (1 species)
ARF1 Guanine nucleotide exchange factor and integrin binding protein homologSpecies Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries) 
Domain d1fhxb_: 1fhx B: [26981]
complexed with 4ip, so4
Details for d1fhxb_
PDB Entry: 1fhx (more details), 2.5 Å
PDB Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol 1,3,4,5-tetrakisphosphate
PDB Compounds: (B:) guanine nucleotide exchange factor and integrin binding protein homolog grp1SCOPe Domain Sequences for d1fhxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhxb_ b.55.1.1 (B:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
npdregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprk
pncfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdp
fydmla
SCOPe Domain Coordinates for d1fhxb_:
Click to download the PDB-style file with coordinates for d1fhxb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fhxb_:
- d1fhxb_ first appeared (with stable ids) in SCOP 1.55
- d1fhxb_ appears in SCOPe 2.07
View in 3D
