Lineage for d1fhwb_ (1fhw B:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
Pfam PF00169
Protein Grp1 [50751] (1 species)
ARF1 Guanine nucleotide exchange factor and integrin binding protein homologSpecies Mouse (Mus musculus) [TaxId:10090] [50752] (6 PDB entries) 
Domain d1fhwb_: 1fhw B: [26978]
complexed with i5p, so4
Details for d1fhwb_
PDB Entry: 1fhw (more details), 1.9 Å
PDB Description: Structure of the pleckstrin homology domain from GRP1 in complex with inositol(1,3,4,5,6)pentakisphosphate
PDB Compounds: (B:) guanine nucleotide exchange factor and integrin binding protein homolog grp1SCOPe Domain Sequences for d1fhwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fhwb_ b.55.1.1 (B:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]}
dregwllklggrvktwkrrwfiltdnclyyfeyttdkeprgiiplenlsirevedprkpn
cfelynpshkgqvikackteadgrvvegnhvvyrisapspeekeewmksikasisrdpfy
dmlatr
SCOPe Domain Coordinates for d1fhwb_:
Click to download the PDB-style file with coordinates for d1fhwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fhwb_:
- d1fhwb_ first appeared (with stable ids) in SCOP 1.55
- d1fhwb_ appears in SCOP 1.75
- d1fhwb_ appears in SCOPe 2.02
- d1fhwb_ appears in the current release, SCOPe 2.08
View in 3D
