Lineage for d1fhjb_ (1fhj B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759481Species Maned wolf (Chrysocyon brachyurus) [TaxId:68728] [63441] (1 PDB entry)
  8. 759482Domain d1fhjb_: 1fhj B: [59838]
    Other proteins in same PDB: d1fhja_, d1fhjc_

Details for d1fhjb_

PDB Entry: 1fhj (more details), 1.8 Å

PDB Description: crystal structure of aquomet hemoglobin-i of the maned wolf (chrysocyon brachyurus) at 2.0 resolution.
PDB Compounds: (B:) hemoglobin (beta chain)

SCOP Domain Sequences for d1fhjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhjb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Maned wolf (Chrysocyon brachyurus) [TaxId: 68728]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1fhjb_:

Click to download the PDB-style file with coordinates for d1fhjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fhjb_: