Lineage for d1fhaa_ (1fha A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314153Protein (Apo)ferritin [47246] (8 species)
  7. 2314454Species Human (Homo sapiens), H chain [TaxId:9606] [47247] (7 PDB entries)
  8. 2314566Domain d1fhaa_: 1fha A: [16675]
    complexed with ca, fe

Details for d1fhaa_

PDB Entry: 1fha (more details), 2.4 Å

PDB Description: solving the structure of human h ferritin by genetically engineering intermolecular crystal contacts
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d1fhaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fhaa_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), H chain [TaxId: 9606]}
tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdk
ndphlcdfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg

SCOPe Domain Coordinates for d1fhaa_:

Click to download the PDB-style file with coordinates for d1fhaa_.
(The format of our PDB-style files is described here.)

Timeline for d1fhaa_: