Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) automatically mapped to Pfam PF03414 |
Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries) Uniprot P14769 |
Domain d1fg5n_: 1fg5 N: [59816] |
PDB Entry: 1fg5 (more details), 2.8 Å
SCOPe Domain Sequences for d1fg5n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fg5n_ c.68.1.9 (N:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]} klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln kyfllnkptkilspeycwdyhiglpadiklvkmswqt
Timeline for d1fg5n_: