Lineage for d1fg3a_ (1fg3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1866062Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1866309Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 1866310Species Escherichia coli [TaxId:562] [64122] (6 PDB entries)
  8. 1866313Domain d1fg3a_: 1fg3 A: [59813]
    complexed with plp

Details for d1fg3a_

PDB Entry: 1fg3 (more details), 2.2 Å

PDB Description: crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol
PDB Compounds: (A:) histidinol phosphate aminotransferase

SCOPe Domain Sequences for d1fg3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg3a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]}
tvtitdlarenvrnltpyqsarrlggngdvwlnaneyptavefqltqqtlnrypecqpka
vienyaqyagvkpeqvlvsrgadegiellirafcepgkdailycpptygmysvsaetigv
ecrtvptldnwqldlqgisdkldgvkvvyvcspnnptgqlinpqdfrtlleltrgkaivv
adeayiefcpqaslagwlaeyphlailrtlskafalaglrcgftlaneevinllmkviap
yplstpvadiaaqalspqgivamrervaqiiaereyliaalkeipcveqvfdsetnyila
rfkassavfkslwdqgiilrdqnkqpslsgclritvgtreesqrvidalraeqv

SCOPe Domain Coordinates for d1fg3a_:

Click to download the PDB-style file with coordinates for d1fg3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fg3a_: