Lineage for d1ffxb_ (1ffx B:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 898313Fold i.10: Microtubule complexes [58193] (1 superfamily)
  4. 898314Superfamily i.10.1: Microtubule complexes [58194] (1 family) (S)
  5. 898315Family i.10.1.1: Microtubule complexes [58195] (2 proteins)
  6. 898321Protein Tubulin:stathmin-like domain complex [58196] (2 species)
  7. 898327Species interspecies complex: Rattus norvegicus and Bos taurus [58197] (1 PDB entry)
  8. 898329Domain d1ffxb_: 1ffx B: [46009]

Details for d1ffxb_

PDB Entry: 1ffx (more details), 3.95 Å

PDB Description: tubulin:stathmin-like domain complex
PDB Compounds: (B:) protein (tubulin)

SCOP Domain Sequences for d1ffxb_:

Sequence, based on SEQRES records: (download)

>d1ffxb_ i.10.1.1 (B:) Tubulin:stathmin-like domain complex {interspecies complex: Rattus norvegicus and Bos taurus}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmm
aacdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprg
lkmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvs
eyqqyqd

Sequence, based on observed residues (ATOM records): (download)

>d1ffxb_ i.10.1.1 (B:) Tubulin:stathmin-like domain complex {interspecies complex: Rattus norvegicus and Bos taurus}
mreivhiqagqcgnqigakfwevisdehgidvyyneaagnkyvprailvdlepgtmdsvr
sgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvrkesescdclqgfqlth
slgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvvepynatlsvhqlventd
etycidnealydicfrtlklttptygdlnhlvsatmsgvttclrfpgqlnadlrklavnm
vpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmmaacdprhgryltvaavf
rgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignstaiqel
fkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqd

SCOP Domain Coordinates for d1ffxb_:

Click to download the PDB-style file with coordinates for d1ffxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ffxb_: