Class g: Small proteins [56992] (98 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) automatically mapped to Pfam PF01907 |
Protein Ribosomal protein L37e [57834] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries) Uniprot P32410 |
Domain d1ffkx_: 1ffk X: [45316] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffky_, d1ffkz_ complexed with cd, k, mg |
PDB Entry: 1ffk (more details), 2.4 Å
SCOPe Domain Sequences for d1ffkx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffkx_ g.41.8.2 (X:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1ffkx_:
View in 3D Domains from other chains: (mouse over for more information) d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffky_, d1ffkz_ |