Lineage for d1ffkx_ (1ffk X:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263551Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2263613Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 2263614Protein Ribosomal protein L37e [57834] (1 species)
  7. 2263615Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 2263655Domain d1ffkx_: 1ffk X: [45316]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffkx_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (X:) ribosomal protein l37e

SCOPe Domain Sequences for d1ffkx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkx_ g.41.8.2 (X:) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1ffkx_:

Click to download the PDB-style file with coordinates for d1ffkx_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkx_: