Lineage for d1ffku_ (1ffk U:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186516Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 2186517Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
    automatically mapped to Pfam PF01198
  5. 2186518Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 2186519Protein Ribosomal protein L31e [54577] (1 species)
  7. 2186520Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 2186560Domain d1ffku_: 1ffk U: [38458]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mg

Details for d1ffku_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (U:) ribosomal protein l31e

SCOPe Domain Sequences for d1ffku_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffku_ d.29.1.1 (U:) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
dfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargr
antpskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1ffku_:

Click to download the PDB-style file with coordinates for d1ffku_.
(The format of our PDB-style files is described here.)

Timeline for d1ffku_: