Lineage for d1ffkt_ (1ffk T:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864307Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 864308Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 864309Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 864310Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 864311Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 864351Domain d1ffkt_: 1ffk T: [39527]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka1, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_
    complexed with cd, k, mo3; mutant

Details for d1ffkt_

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
PDB Compounds: (T:) ribosomal protein l30

SCOP Domain Sequences for d1ffkt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffkt_ d.59.1.1 (T:) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOP Domain Coordinates for d1ffkt_:

Click to download the PDB-style file with coordinates for d1ffkt_.
(The format of our PDB-style files is described here.)

Timeline for d1ffkt_: